PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013627201.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LFY
Protein Properties Length: 415aa    MW: 46269.9 Da    PI: 6.7885
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013627201.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY608.71.2e-18513921386
         FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslse 95 
                     mdpe f++ lf+w+p  +++++pa + + +++s+a  + ++aa  ++l +le lf  yGvr++t+akiaelGft+stLv+mkdeel+d+m+sls+
  XP_013627201.1   1 MDPEGFTSGLFRWNPTRVMVQAPAPIPPPQQQSPA--TPQTAAFGMRLGGLEGLFGPYGVRFYTAAKIAELGFTASTLVGMKDEELEDMMNSLSH 93 
                     9*************999998888888777654444..467777788899********************************************** PP

         FLO_LFY  96 ifrldllvGeryGikaavraerrrlee..eeaekkrrkll...sedeet..aldalsqe....glseepvqeekeaagsggeglgeaelvaaeek 179
                     ifr++llvGeryGikaavraerrrl+e  ee++++rr+ll   + d+ t  aldalsqe    gls+epvq++ ++ ++g +g g+ +   a ++
  XP_013627201.1  94 IFRWELLVGERYGIKAAVRAERRRLQEeeEEESSRRRHLLlsaAGDSGThlALDALSQEddwtGLSQEPVQHQDQTDAAGINGGGRGGYWEAGQT 188
                     *************************995444567778877787455544569******988889******9976655555555445555444422 PP

         FLO_LFY 180 kseeekkkaskkkqkrkkkkelkseededeeeeededeeg...sgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiak 271
                        + kk++ + ++++k+  + + e+d+d +e ed+d+++   ++ +g+erqrehPfivtepgevargkknGLDYLf+LyeqCrefLlqvq+iak
  XP_013627201.1 189 ---TIKKQQ-Q-RRRKKTIVT-SVETDDDGNEGEDDDGMDvvnGSGSGMERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCREFLLQVQTIAK 277
                     ...222222.2.333333333.334444444444444444333667789********************************************** PP

         FLO_LFY 272 erGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLs 366
                     +rGekcPtkvtnqvfryakk+ga+yinkPkmrhYvhCYalhcLdeeasnalrrafkergenvG+wrqacykplv+ia r+gwdidavfnahprLs
  XP_013627201.1 278 DRGEKCPTKVTNQVFRYAKKSGANYINKPKMRHYVHCYALHCLDEEASNALRRAFKERGENVGSWRQACYKPLVDIACRHGWDIDAVFNAHPRLS 372
                     *********************************************************************************************** PP

         FLO_LFY 367 iWYvPtkLrqLChlerskas 386
                     iWYvPtkLrqLChler++a+
  XP_013627201.1 373 IWYVPTKLRQLCHLERNNAV 392
                     ****************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016988.2E-1961391IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MDPEGFTSGL FRWNPTRVMV QAPAPIPPPQ QQSPATPQTA AFGMRLGGLE GLFGPYGVRF  60
YTAAKIAELG FTASTLVGMK DEELEDMMNS LSHIFRWELL VGERYGIKAA VRAERRRLQE  120
EEEEESSRRR HLLLSAAGDS GTHLALDALS QEDDWTGLSQ EPVQHQDQTD AAGINGGGRG  180
GYWEAGQTTI KKQQQRRRKK TIVTSVETDD DGNEGEDDDG MDVVNGSGSG MERQREHPFI  240
VTEPGEVARG KKNGLDYLFH LYEQCREFLL QVQTIAKDRG EKCPTKVTNQ VFRYAKKSGA  300
NYINKPKMRH YVHCYALHCL DEEASNALRR AFKERGENVG SWRQACYKPL VDIACRHGWD  360
IDAVFNAHPR LSIWYVPTKL RQLCHLERNN AVAAAATLVG GISCEGSPAS GRFGV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1272304152187PROTEIN LEAFY
2vy2_A1e-1272304152187PROTEIN LEAFY
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankZ183620.0Z18362.1 Brassica oleracea gene encoding BOFH.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013627201.10.0PREDICTED: putative transcription factor BOFH isoform X1
SwissprotQ055360.0BOFH_BRAOB; Putative transcription factor BOFH
TrEMBLA0A0D3BFZ20.0A0A0D3BFZ2_BRAOL; Uncharacterized protein
STRINGBra019619.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.10.0floral meristem identity control protein LEAFY (LFY)